METAP1 Antibody - N-terminal region : FITC

METAP1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55179_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: METAP1 removes the amino-terminal methionine from nascent proteins. METAP1 is required for normal progression through the cell cycle.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human METAP1

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: GDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Methionine aminopeptidase 1

Protein Size: 386

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55179_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55179_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23173
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×