MGC45491 Antibody - middle region : FITC

MGC45491 Antibody - middle region : FITC
Artikelnummer
AVIARP55574_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of MGC45491 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MGC45491

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: CRPLRPLLGFRESDSAKPASLRLLQHTPSARRNYRIAGARLMRSNYPPPL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Uncharacterized protein C6orf223

Protein Size: 242

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55574_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55574_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 221416
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×