MINDY1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM63A

Key Reference: Lehner,B. (2004) Genome Res. 14 (7), 1315-1323

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: LQQEEYQQQQAAQPVRMRTRVLSLQGRGATSGRPAGERRQRPKHESDCIL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ubiquitin carboxyl-terminal hydrolase MINDY-1

Protein Size: 327

Purification: Affinity Purified

• Artikelnummer: AVIARP56272_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56272_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55793
• Wirt: Rabbit