MYL4 Antibody - N-terminal region : Biotin

MYL4 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56153_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that is found in embryonic muscle and adult atria. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MYL4

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Myosin light chain 4

Protein Size: 197

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56153_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56153_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4635
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×