MYL4 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that is found in embryonic muscle and adult atria. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MYL4

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Myosin light chain 4

Protein Size: 197

Purification: Affinity Purified

• Artikelnummer: AVIARP56153_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56153_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 4635
• Wirt: Rabbit