NDUFS3 Antibody - middle region : Biotin

NDUFS3 Antibody - middle region : Biotin
Artikelnummer
AVIARP56579_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes one of the iron-sulfur protein (IP) components of mitochondrial NADH:ubiquinone oxidoreductase (complex I). Mutations in this gene are associated with Leigh syndrome resulting from mitochondrial complex I deficiency.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NDUFS3

Key Reference: Vogel,R.O., (2007) J. Biol. Chem. 282 (10), 7582-7590

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: EVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial

Protein Size: 264

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56579_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56579_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4722
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×