NGRN Antibody - N-terminal region : HRP

NGRN Antibody - N-terminal region : HRP
Artikelnummer
AVIARP58748_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: NGRN may be involved in neuronal differentiation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NGRN

Key Reference: Ishigaki,S., (2000) Biochem. Biophys. Res. Commun. 279 (2), 526-533

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: MAVTLSLLLGGRVCAAVTRCGFATRGVAGPGPIGREPDPDSDWEPEEREL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Neugrin

Protein Size: 291

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58748_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58748_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Dog (Canine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51335
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×