NLRP2 Antibody - C-terminal region : FITC

NLRP2 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP57052_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NALP proteins, such as NALP2, are characterized by an N-terminal pyrin (MIM 608107) domain (PYD) and are involved in the activation of caspase-1 (CASP1; MIM 147678) by Toll-like receptors (see TLR4; MIM 603030). They may also be involved in protein complexes that activate proinflammatory caspases (Tschopp et al., 2003 [PubMed 12563287]).

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NLRP2

Molecular Weight: 120kDa

Peptide Sequence: Synthetic peptide located within the following region: FETLTCSSGTLRTLRLKIDDFNDELNKLLEEIEEKNPQLIIDTEKHHPWA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NACHT, LRR and PYD domains-containing protein 2

Protein Size: 1062

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57052_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57052_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55655
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×