NOB1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: NOB1 may play a role in mRNA degradation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NOB1

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: TEIRDKATRRRLAVLPYELRFKEPLPEYVRLVTEFSKKTGDYPSLSATDI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: RNA-binding protein NOB1

Protein Size: 412

Purification: Affinity Purified

• Artikelnummer: AVIARP54975_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54975_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 28987
• Wirt: Rabbit