English
NPM2 Antibody - N-terminal region : FITC
NPM2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58311_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate
Description of Target: NPM2 belongs to the nucleoplasmin family. It probably involved in sperm DNA decondensation during fertilization.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NPM2
Key Reference: Burns,K.H., (2003) Science 300 (5619), 633-636
Molecular Weight: 24kDa
Peptide Sequence: Synthetic peptide located within the following region: LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQA
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Nucleoplasmin-2
Protein Size: 214
Purification: Affinity Purified
Description of Target: NPM2 belongs to the nucleoplasmin family. It probably involved in sperm DNA decondensation during fertilization.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NPM2
Key Reference: Burns,K.H., (2003) Science 300 (5619), 633-636
Molecular Weight: 24kDa
Peptide Sequence: Synthetic peptide located within the following region: LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQA
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Nucleoplasmin-2
Protein Size: 214
Purification: Affinity Purified
| Artikelnummer | AVIARP58311_P050FITC |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58311_P050-FITC |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 10361 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
