Nppc Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the natriuretic peptide family. Natriuretic peptides are involved in the control of blood pressure, extracellular fluid volume and electrolyte homeostasis. The encoded protein also plays a role in sensory neuron bifurcation, and is a critical regulator of endochondral bone growth. The encoded protein is a ligand for the natriuretic peptide receptor B, and is synthesized as a preprohormone which is cleaved to produce a mature peptide. Mutations in this gene are associated with dwarfism resulting from impaired endochondral ossification.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Nppc

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: LLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: C-type natriuretic peptide

Protein Size: 126

Purification: Affinity Purified

• Artikelnummer: AVIARP57660_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57660_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 18159
• Wirt: Rabbit