NRARP Antibody - middle region : Biotin

NRARP Antibody - middle region : Biotin
Artikelnummer
AVIARP56166_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: NRARP may play a role in the formation of somites.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NRARP

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 12kDa

Peptide Sequence: Synthetic peptide located within the following region: QNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Notch-regulated ankyrin repeat-containing protein

Protein Size: 114

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56166_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56166_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 441478
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×