NRP1 Antibody - N-terminal region : FITC

NRP1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP59101_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NRP1 is a membrane-bound coreceptor to a tyrosine kinase receptor for both vascular endothelial growth factor (VEGF; MIM 192240) and semaphorin (see SEMA3A; MIM 603961) family members. NRP1 plays versatile roles in angiogenesis, axon guidance, cell survival, migration, and invasion.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NRP1

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: FNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Neuropilin-1

Protein Size: 644

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59101_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59101_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 8829
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×