OGDHL Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of OGDHL remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OGDHL

Molecular Weight: 114kDa

Peptide Sequence: Synthetic peptide located within the following region: VFGWRSRSSGPPATFPSSKGGGGSSYMEEMYFAWLENPQSVHKSWDSFFR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 2-oxoglutarate dehydrogenase-like, mitochondrial

Protein Size: 1010

Purification: Affinity Purified

• Artikelnummer: AVIARP57175_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57175_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55753
• Wirt: Rabbit