OLAH Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: OLAH plays a role in fatty acid biosynthesis chain termination and release of the free fatty acid product is achieved by hydrolysis of the thio ester by a thioesterase I, a component of the fatty acid synthetase complex. The chain length of the released f

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OLAH

Key Reference: Nakamura,N., (2006) DNA Res. 13 (4), 169-183

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: MGGGSTHFAKWGQDTHDLLEVHSLRLPGRESRVEEPLENDISQLVDEVVC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: S-acyl fatty acid synthase thioesterase, medium chain

Protein Size: 265

Purification: Affinity Purified

• Artikelnummer: AVIARP56263_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56263_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Pig (Porcine), Rabbit, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55301
• Wirt: Rabbit