Omp Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Omp may act as a modulator of the olfactory signal-transduction cascade.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: EDSDAMDWNEADALEFGERLSDLAKIRKVMYFLITFGEGVEPANLKASVV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Olfactory marker protein

Protein Size: 163

Purification: Affinity Purified

• Artikelnummer: AVIARP56669_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56669_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 18378
• Wirt: Rabbit