Orc2 Antibody - C-terminal region : Biotin

Orc2 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP56670_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Orc2

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: LMWDHAKQSLYNWLWYETTTYSPYTEETSYENSLLVKQSGSLPLSSLIHV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Origin recognition complex subunit 2 Ensembl ENSMUSP00000109964

Protein Size: 528

Purification: Affinity Purified

Subunit: 2
Mehr Informationen
Artikelnummer AVIARP56670_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56670_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 18393
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×