PANK4 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein belonging to the pantothenate kinase family. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynt

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PANK4

Key Reference: 0

Molecular Weight: 86kDa

Peptide Sequence: Synthetic peptide located within the following region: MAECGASGSGSSGDSLDKSITLPPDEIFRNLENAKRFAIDIGGSLTKLAY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pantothenate kinase 4

Protein Size: 773

Purification: Affinity Purified

• Artikelnummer: AVIARP57155_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57155_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55229
• Wirt: Rabbit