PAX1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The PAX genes, including PAX1, are a highly conserved family of developmental control genes that encode transcription factors and have been shown to play a role in pattern formation during embryogenesis in vertebrates.The PAX genes, including PAX1, are a highly conserved family of developmental control genes that encode transcription factors and have been shown to play a role in pattern formation during embryogenesis in vertebrates (McGaughran et al., 2003 [PubMed 12774041]). See PAX7 (MIM 167410) for a discussion of paired box domain genes.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PAX1

Key Reference: Vatanavicharn,N., (2007) Am. J. Med. Genet. A 143 (19), 2292-2302

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: SISRILRNKIGSLAQPGPYEASKQPPSQPTLPYNHIYQYPYPSPVSPTGA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Paired box protein Pax-1

Protein Size: 440

Purification: Affinity Purified

• Artikelnummer: AVIARP58040_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58040_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5075
• Wirt: Rabbit