PDE4B Antibody - middle region : Biotin

PDE4B Antibody - middle region : Biotin
Artikelnummer
AVIARP56256_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.This gene is a member of the type IV, cyclic AMP (cAMP)-specific, cyclic nucleotide phosphodiesterase (PDE) family. Cyclic nucleotides are important second messengers that regulate and mediate a number of cellular responses to extracellular signals, such as hormones, light, and neurotransmitters. The cyclic nucleotide phosphodiesterases (PDEs) regulate the cellular concentrations of cyclic nucleotides and thereby play a role in signal transduction. This gene encodes a protein that specifically hydrolyzes cAMP. Altered activity of this protein has been associated with schizophrenia and bipolar affective disorder. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDE4B

Key Reference: Fatemi,S.H., Schizophr. Res. 101 (1-3), 36-49 (2008)

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: QDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEED

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphodiesterase 4B, cAMP-specific (Phosphodiesterase E4 dunce homolog, Drosophila) EMBL CAI21750.1

Protein Size: 564

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56256_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56256_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5142
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×