PDE4B Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.This gene is a member of the type IV, cyclic AMP (cAMP)-specific, cyclic nucleotide phosphodiesterase (PDE) family. Cyclic nucleotides are important second messengers that regulate and mediate a number of cellular responses to extracellular signals, such as hormones, light, and neurotransmitters. The cyclic nucleotide phosphodiesterases (PDEs) regulate the cellular concentrations of cyclic nucleotides and thereby play a role in signal transduction. This gene encodes a protein that specifically hydrolyzes cAMP. Altered activity of this protein has been associated with schizophrenia and bipolar affective disorder. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDE4B

Key Reference: Fatemi,S.H., Schizophr. Res. 101 (1-3), 36-49 (2008)

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: QDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEED

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphodiesterase 4B, cAMP-specific (Phosphodiesterase E4 dunce homolog, Drosophila) EMBL CAI21750.1

Protein Size: 564

Purification: Affinity Purified

• Artikelnummer: AVIARP56256_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56256_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5142
• Wirt: Rabbit