Pde4b Antibody - N-terminal region : FITC

Pde4b Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56255_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 82kDa

Peptide Sequence: Synthetic peptide located within the following region: LVNKSIRQRRRFTVAHTCFDVENGPSPGRSPLDPQAGSSSGLVLHAAFPG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: CAMP-specific phosphodiesterase EMBL AAF19202.2

Protein Size: 721

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56255_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56255_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 18578
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×