Pde4d Antibody - N-terminal region : HRP

Pde4d Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56672_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Pde4d hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 84kDa

Peptide Sequence: Synthetic peptide located within the following region: PFAQVLASLRTVRNNFAALTNLQDRAPSKRSPMCNQPSINKATITEEAYQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: cAMP-specific 3',5'-cyclic phosphodiesterase 4D

Protein Size: 747

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56672_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56672_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 238871
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×