PDP2 Antibody - middle region : HRP

PDP2 Antibody - middle region : HRP
Artikelnummer
AVIARP57451_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PDP2 catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDP2

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: CRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMED

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial

Protein Size: 529

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57451_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57451_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57546
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×