PDYN Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is a preproprotein that is proteolytically processed to form the secreted opioid peptides beta-neoendorphin, dynorphin, leu-enkephalin, rimorphin, and leumorphin. These peptides are ligands for the kappa-type of opioid receptor. Dynorphin is involved in modulating responses to several psychoactive substances, including cocaine. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDYN

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: SELMRDAQLNDGAMETGTLYLAEEDPKEQVKRYGGFLRKYPKRSSEVAGE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proenkephalin-B

Protein Size: 254

Purification: Affinity Purified

• Artikelnummer: AVIARP57661_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57661_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5173
• Wirt: Rabbit