English
Pi4k2b Antibody - N-terminal region : Biotin
Pi4k2b Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57203_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: Together with PI4K2A and the type III PI4Ks (PIK4CA and PIK4CB) Pi4k2b contributes to the overall PI4-kinase activity of the cell. This contribution may be especially significant in plasma membrane, endosomal and Golgi compartments. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). Pi4k2b contributes to the production of InsP3 in stimulated cells and is likely to be involved in the regulation of vesicular trafficking.
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Molecular Weight: 52kDa
Peptide Sequence: Synthetic peptide located within the following region: EDPEFADIVLKAEQAIEIGVFPERISQGSSGSYFVKDSKRNIIGVFKPKS
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Phosphatidylinositol 4-kinase type 2-beta
Protein Size: 469
Purification: Affinity Purified
Description of Target: Together with PI4K2A and the type III PI4Ks (PIK4CA and PIK4CB) Pi4k2b contributes to the overall PI4-kinase activity of the cell. This contribution may be especially significant in plasma membrane, endosomal and Golgi compartments. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). Pi4k2b contributes to the production of InsP3 in stimulated cells and is likely to be involved in the regulation of vesicular trafficking.
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Molecular Weight: 52kDa
Peptide Sequence: Synthetic peptide located within the following region: EDPEFADIVLKAEQAIEIGVFPERISQGSSGSYFVKDSKRNIIGVFKPKS
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Phosphatidylinositol 4-kinase type 2-beta
Protein Size: 469
Purification: Affinity Purified
| Artikelnummer | AVIARP57203_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP57203_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 67073 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
