PI4KB Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Phosphorylates phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol-1,4,5,-trisphosphate (PIP). PI4KB may regulate Golgi disintegration/reorganization during mitosis, possibly via its phosphorylation. Involved in Golgi-to-plasma membrane trafficking.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PI4KB

Molecular Weight: 93kDa

Peptide Sequence: Synthetic peptide located within the following region: HMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphatidylinositol 4-kinase beta

Protein Size: 828

Purification: Affinity Purified

• Artikelnummer: AVIARP56394_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56394_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 5298
• Wirt: Rabbit