PI4KB Antibody - middle region : FITC

PI4KB Antibody - middle region : FITC
Artikelnummer
AVIARP56394_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Phosphorylates phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol-1,4,5,-trisphosphate (PIP). PI4KB may regulate Golgi disintegration/reorganization during mitosis, possibly via its phosphorylation. Involved in Golgi-to-plasma membrane trafficking.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PI4KB

Molecular Weight: 93kDa

Peptide Sequence: Synthetic peptide located within the following region: HMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphatidylinositol 4-kinase beta

Protein Size: 828

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56394_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56394_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 5298
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×