PIK3R5 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Receptor-regulated class I phosphoinositide 3-kinases (PI3Ks) phosphorylate the membrane lipid phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) to PtdIns(3,4,5)P3, which in turn recruits and activates cytosolic effectors involved in proliferation, survival, or chemotaxis. PIK3R5 is a PI3K regulatory subunit.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PIK3R5

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: SRAQRSRSLPQPKLGTQLPSWLLAPASRPQRRRPFLSGDEDPKASTLRVV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphoinositide 3-kinase regulatory subunit 5

Protein Size: 880

Purification: Affinity Purified

Subunit: 5

• Artikelnummer: AVIARP55012_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55012_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23533
• Wirt: Rabbit