PIK3R5 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Receptor-regulated class I phosphoinositide 3-kinases (PI3Ks) phosphorylate the membrane lipid phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) to PtdIns(3,4,5)P3, which in turn recruits and activates cytosolic effectors involved in proliferation, survival, or chemotaxis. PIK3R5 is a PI3K regulatory subunit.Receptor-regulated class I phosphoinositide 3-kinases (PI3Ks) phosphorylate the membrane lipid phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) to PtdIns(3,4,5)P3, which in turn recruits and activates cytosolic effectors involved in proliferation, survival, or chemotaxis. PIK3R5 is a PI3K regulatory subunit (Brock et al., 2003 [PubMed 12507995]).[supplied by OMIM]. Sequence Note: removed 2 bases from the 3' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-3253 AF128881.1 1-3253

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIK3R5

Key Reference: Johnson,C., (2007) Oncogene 26 (49), 7049-7057

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: HRFLTWPVPYCSICQELLTFIDAELKAPGISYQRLVRAEQGLPIRSHRSS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphoinositide 3-kinase regulatory subunit 5

Protein Size: 880

Purification: Affinity Purified

Subunit: 5

• Artikelnummer: AVIARP55011_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55011_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23533
• Wirt: Rabbit