PLDN Antibody - middle region : HRP

PLDN Antibody - middle region : HRP
Artikelnummer
AVIARP54890_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PLDN may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion.The protein encoded by this gene may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLDN

Key Reference: Stelzl,U., (2005) Cell 122 (6), 957-968

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: EGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Biogenesis of lysosome-related organelles complex 1 subunit 6

Protein Size: 172

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54890_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54890_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26258
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×