PLDN Antibody - N-terminal region : Biotin

PLDN Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP54889_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: PLDN may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLDN

Key Reference: Stelzl,U., (2005) Cell 122 (6), 957-968

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Biogenesis of lysosome-related organelles complex 1 subunit 6

Protein Size: 172

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54889_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54889_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26258
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×