PLEKHA9 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLEKHA9

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: VGTLLKSTCNTFLKTLEECMQIANAAFTSELLYHTPPGSPQLAMLKSSKM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative protein PLEKHA9

Protein Size: 391

Purification: Affinity Purified

• Artikelnummer: AVIARP56767_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56767_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51054
• Wirt: Rabbit