English
PLXNA4 Antibody - middle region : HRP
PLXNA4 Antibody - middle region : HRP
Artikelnummer
AVIARP58514_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: This protein mediates semaphorin receptor activity.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLXNA4
Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270
Molecular Weight: 57kDa
Peptide Sequence: Synthetic peptide located within the following region: TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRVQPLLCCFLNV
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Plexin A4, B, isoform CRA_a EMBL EAW83793.1
Protein Size: 522
Purification: Affinity Purified
Description of Target: This protein mediates semaphorin receptor activity.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLXNA4
Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270
Molecular Weight: 57kDa
Peptide Sequence: Synthetic peptide located within the following region: TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRVQPLLCCFLNV
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Plexin A4, B, isoform CRA_a EMBL EAW83793.1
Protein Size: 522
Purification: Affinity Purified
| Artikelnummer | AVIARP58514_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58514_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Yeast |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 91584 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
