PNMA8A Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PNMAL1

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: APMRKKKKVSLGPVSYVLVDSEDGRKKPVMPKKGPGSRREASDQKAPRGQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: paraneoplastic antigen-like protein 8A

Protein Size: 439

Purification: Affinity Purified

• Artikelnummer: AVIARP57154_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57154_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Dog (Canine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55228
• Wirt: Rabbit