PNN Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PNN is the transcriptional activator binding to the E-box 1 core sequence of the E-cadherin promoter gene; the core-binding sequence is 5'CAGGTG-3'. PNN is capable of reversing CTBP1-mediated transcription repression. Component of a splicing-dependent mul

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PNN

Key Reference: Alpatov,R., (2008) Mol. Cell. Biol. 28 (5), 1584-1595

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pinin

Protein Size: 717

Purification: Affinity Purified

• Artikelnummer: AVIARP56403_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56403_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5411
• Wirt: Rabbit