PNPLA8 Antibody - middle region : HRP

PNPLA8 Antibody - middle region : HRP
Artikelnummer
AVIARP56759_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Phospholipase A2 catalyzes cleavage of fatty acids from phospholipids, thereby regulating membrane physical properties and the release of lipid second messengers and growth factors. Phospholipase A2 activity also modulates cellular growth programs, inflam

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PNPLA8

Key Reference: Mungall,A.J., (2003) Nature 425 (6960), 805-811

Molecular Weight: 88kDa

Peptide Sequence: Synthetic peptide located within the following region: IDNRTRALVQALRRTTDPKLCITRVEELTFHLLEFPEGKGVAVKERIIPY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Calcium-independent phospholipase A2-gamma

Protein Size: 782

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56759_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56759_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 50640
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×