PNRC2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: PNRC2 is involved in nonsense-mediated mRNA decay (NMD) by acting as a bridge between the mRNA decapping complex and the NMD machinery.PNRC2 may act by targeting the NMD machinery to the P-body and recruiting the decapping machinery to aberrant mRNAs. PNRC2 is required for UPF1/RENT1 localization to the P-body. PNRC2 also acts as a nuclear receptor coactivator. PNRC2 may play a role in controlling the energy balance between energy storage and energy expenditure.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PNRC2

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: NQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proline-rich nuclear receptor coactivator 2

Protein Size: 139

Purification: Affinity Purified

• Artikelnummer: AVIARP57028_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57028_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55629
• Wirt: Rabbit