Pnrc2 Antibody - N-terminal region : Biotin

Pnrc2 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57027_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Pnrc2 is involved in nonsense-mediated mRNA decay (NMD) by acting as a bridge between the mRNA decapping complex and the NMD machinery. It may act by targeting the NMD machinery to the P-body and recruiting the decapping machinery to aberrant mRNAs. It is required for UPF1/RENT1 localization to the P-body.It also acts as a nuclear receptor coactivator. It may play a role in controlling the energy balance between energy storage and energy expenditure.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: MGGGERYNIPDPQSRNASKNQQQHNRQKTKDQNSQMKIVHKKKERGHGYN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proline-rich nuclear receptor coactivator 2

Protein Size: 134

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57027_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57027_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 100125373
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×