POLB Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: In eukaryotic cells, DNA polymerase beta (POLB) performs base excision repair (BER) required for DNA maintenance, replication, recombination, and drug resistance. Also see POLA (MIM 312040).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POLB

Key Reference: Batra,V.K., (2008) Mol. Cell 30 (3), 315-324

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: GPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEML

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DNA polymerase beta

Protein Size: 335

Purification: Affinity Purified

• Artikelnummer: AVIARP56406_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56406_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 5423
• Wirt: Rabbit