PPM1A Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase dephosphorylates, and negatively regulates the acti

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPM1A

Key Reference: Wu,S.K., (2007) World J. Gastroenterol. 13 (34), 4554-4559

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: EIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein phosphatase 1A

Protein Size: 324

Purification: Affinity Purified

• Artikelnummer: AVIARP57765_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57765_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5494
• Wirt: Rabbit