PPM1B Antibody - N-terminal region : Biotin

PPM1B Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57767_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase has been shown to dephosphorylate cyclin-dependent

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPM1B

Key Reference: Xiao,K., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (29), 12011-12016

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: EIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein phosphatase 1B

Protein Size: 192

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57767_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57767_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5495
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×