PPM1J Antibody - N-terminal region : HRP

PPM1J Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54744_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PPM1J is the serine/threonine protein phosphatase. The mouse homolog of this protein apparently belongs to the protein phosphatase 2C family. The exact function of this protein is not yet known. This gene encodes the serine/threonine protein phosphatase. The mouse homolog of this gene apparently belongs to the protein phosphatase 2C family of genes. The exact function of this gene is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPM1J

Key Reference: Komaki,K., Biochim. Biophys. Acta 1630 (2-3), 130-137 (2003)

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: TFLQLSPGGLRRADDHAGRAVQSPPDTGRRLPWSTGYAEVINAGKSRHNE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein phosphatase 1J

Protein Size: 505

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54744_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54744_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 333926
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×