PPP2R3A Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Protein phosphatase 2 (formerly named type 2A) is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2 holoenzymes are heterotrimeric proteins composed of a structural subu

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPP2R3A

Key Reference: Ahn,J.H., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (23), 9876-9881

Molecular Weight: 130kDa

Peptide Sequence: Synthetic peptide located within the following region: SSSVEEKPLSHRNSLDTNLTSMFLQNFSEEDLVTQILEKHKIDNFSSGTD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha

Protein Size: 1150

Purification: Affinity Purified

Subunit: B

• Artikelnummer: AVIARP56410_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56410_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 5523
• Wirt: Rabbit