PPP2R5C Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common het

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPP2R5C

Key Reference: Shouse,G.P., (2008) Mol. Cell. Biol. 28 (1), 448-456

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein phosphatase 2, regulatory subunit B', gamma isoform EMBL AAH16183.1

Protein Size: 384

Purification: Affinity Purified

Subunit: gamma isoform

• Artikelnummer: AVIARP57771_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57771_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5527
• Wirt: Rabbit