PPP4C Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: PPP4C is a protein phosphatase that is involved in many processes such as microtubule organization at centrosomes, maturation of spliceosomal snRNPs, apoptosis, tumor necrosis factor (TNF)-alpha signaling, activation of c-Jun N-terminal kinase MAPK8, regulation of histone acetylation, DNA damage checkpoint signaling, NF-kappa-B activation and cell migration. The PPP4C-PPP4R1 PP4 complex may play a role in dephosphorylation and regulation of HDAC3. The PPP4C-PPP4R2-PPP4R3A PP4 complex specifically dephosphorylates H2AFX phosphorylated on Ser-140 (gamma-H2AFX) generated during DNA replication and required for DNA DSB repair. Dephosphorylates NDEL1 at CDC2/Cdk1 phosphorylation sites and negatively regulates CDC2/Cdk1 activity in interphase.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPP4C

Key Reference: Humphray,S.J., (2008) J. Cell Biol. 180 (6), 1133-1147

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: TVLTVWSAPNYCYRCGNVAAILELDEHLQKDFIIFEAAPQETRGIPSKKP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine/threonine-protein phosphatase 4 catalytic subunit

Protein Size: 307

Purification: Affinity Purified

• Artikelnummer: AVIARP58516_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58516_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5531
• Wirt: Rabbit