PPP4R3B Antibody - C-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 90kDa

Peptide Sequence: Synthetic peptide located within the following region: DSYEKFMETKKAKESEDKENLPKRASSGGFKFTFSHSPSATNGTNSTNSK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: serine/threonine-protein phosphatase 4 regulatory subunit 3B

Protein Size: 820

Purification: Affinity Purified

Subunit: 3B

• Artikelnummer: AVIARP57424_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57424_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 104570
• Wirt: Rabbit