PPP6R1 Antibody - N-terminal region : FITC

PPP6R1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55109_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Protein phosphatase regulatory subunits, such as SAPS1, modulate the activity of protein phosphatase catalytic subunits by restricting substrate specificity, recruiting substrates, and determining the intracellular localization of the holoenzyme. SAPS1 is a regulatory subunit for the protein phosphatase-6 catalytic subunit (PPP6C; MIM 300141) (Stefansson and Brautigan, 2006 [PubMed 16769727]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPP6R1

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: MFWKFDLHTSSHLDTLLEREDLSLPELLDEEDVLQECKVVNRKLLDFLLQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein phosphatase 6 regulatory subunit 1

Protein Size: 881

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55109_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55109_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 22870
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×