PRAP1 Antibody - C-terminal region : Biotin

PRAP1 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP58517_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: PRAP1 may play an important role in maintaining normal growth homeostasis in epithelial cells.

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: VLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proline-rich acidic protein 1

Protein Size: 151

Purification: Affinity Purified

Specificity#: Predicted reactivity to isoforms 1, 3, 4.
Mehr Informationen
Artikelnummer AVIARP58517_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58517_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 118471
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×