PRDX5 Antibody - middle region : Biotin

PRDX5 Antibody - middle region : Biotin
Artikelnummer
AVIARP54831_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. This protein interacts with peroxisome receptor 1. The crystal structure of this protein in its reduced form has been resolved to 1.5 angstrom resolution. This gene uses alternate in-frame translation initiation sites to generate mitochondrial or peroxisomal/cytoplasmic forms. Three transcript variants encoding distinct isoforms have been identified for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human PRDX5

Key Reference: N/A

Molecular Weight: 17 kDa

Peptide Sequence: Synthetic peptide located within the following region: VACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peroxiredoxin-5, mitochondrial

Protein Size: 162

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP54831_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54831_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 25824
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×